PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001092G0270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family TALE
Protein Properties Length: 505aa    MW: 53416.4 Da    PI: 6.8974
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001092G0270genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.3e-092212581954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+ +++  L+k++gLt +qV++WF N R +
  PH01001092G0270 221 FEHflHPYPKDSDKIMLSKQTGLTRSQVSNWFINARVR 258
                      554459******************************88 PP

2BELL119.61.4e-3883154172
             BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      erqelq+kk+kL+++l+eV++rY+qy++q+q+v+ssFeavag+gsa+ Yt+lAl++iS++FrcL+daia q+
  PH01001092G0270  83 ERQELQMKKSKLVNMLDEVEQRYRQYHHQMQAVASSFEAVAGVGSARTYTALALRTISQQFRCLRDAIATQV 154
                      79*******************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.8E-537152IPR006563POX domain
PfamPF075263.6E-4913151IPR006563POX domain
PROSITE profilePS5007111.58199262IPR001356Homeobox domain
CDDcd000865.66E-13202263No hitNo description
SMARTSM003891.2E-9202266IPR001356Homeobox domain
SuperFamilySSF466891.15E-16203268IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28205268IPR009057Homeodomain-like
PfamPF059205.0E-18219258IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 505 aa     Download sequence    Send to blast
MGASPTPSQE HAVMSSKYLM TAQELLDEVV GVSKGVEEAN AAAAKSAMAV KKKEDSEGGS  60
GGGAEDGGGG SKSGGAAEMS TAERQELQMK KSKLVNMLDE VEQRYRQYHH QMQAVASSFE  120
AVAGVGSART YTALALRTIS QQFRCLRDAI ATQVRSASRA LGEDTVAAAG GRTVGSRLLF  180
IDHHLRQQRA QQQLGMMQGG AWRPQRGLPE RAVSVLRAWL FEHFLHPYPK DSDKIMLSKQ  240
TGLTRSQVSN WFINARVRLW KPMVEEMYLE ETKDKDANAA AGAGDDNSGG GGKMSNNTDG  300
TEPPKHVDNG MSSSAGTTSK GERMAGIGSS KVNVHASLLE LAGDQQAQAS FYGRDGGSGA  360
SFQHKLKKAR TDDPAAFHAS DVATLSRHDE AVSHRELLMK FMEAGGSGAA AGARCQQDDD  420
DVGGYSLFTP PPYRQFGSEQ YAFAGNSGGV SLTLGLPHGA GAAEQTTSFL MSSSNASDGV  480
AAGYDTNMQS TKSIAAQLMR DFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A2e-17208266563Homeobox protein Meis2
4xrm_B2e-17208266563Homeobox protein Meis2
5bng_A2e-17208266159Homeobox protein Meis2
5bng_B2e-17208266159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978743.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_004978744.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_004978738.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_012703953.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_004978740.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-102BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLK3ZHN10.0K3ZHN1_SETIT; Uncharacterized protein
STRINGSi026083m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48163758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.38e-88BEL1-like homeodomain 1